Our products are intended for research and investigative use only. They are not for human consumption, clinical or therapeutic use, and are not intended to diagnose, treat, cure, or prevent any disease.
Cagrilintide
Dual GIP/GLP-1 receptor agonist for advanced metabolic research. This novel compound enables studies in dual-incretin pathways and their effects on metabolic function.
Price range: $69.00 through $94.99
Research-grade purity
Third-party tested
Lyophilized powder
Sterile filtered
Dual GIP/GLP-1 receptor agonist for advanced metabolic research. This novel compound enables studies in dual-incretin pathways and their effects on metabolic function. Our products undergo rigorous quality control and are manufactured under strict laboratory conditions to ensure the highest standards for research applications.
CAS Number
1415456-99-3
PubChem CID
171397054
Molecular Weight
4409.01 g/mol
Molecular Formula
C194H312N54O59S2
Synonyms
AM833, NNC0174-0833, NN9838, Cagrilintide acetate (common salt form)
Amino Acid Sequence
KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2; C-terminal amidation, intramolecular disulfide bridge between Cys2-Cys7, N-terminal Lys(1) acylated with a C20 eicosanedioic (fatty diacid) chain via a gamma-Glu linker
Appearance
Lyophilized white to off-white powder
Storage Conditions
Store lyophilized powder at -20°C (long-term at -80°C), protected from light and moisture; once reconstituted, store at 2-8°C and use within 2-4 weeks. Avoid repeated freeze-thaw cycles.
Lab results not available.



